PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.DX46F
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 185aa    MW: 21423.5 Da    PI: 9.3086
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.DX46FgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17.1e-194095156
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                 r k+ ++t++q+e Le+ F+++ +++ +++ +L+++lgL+ rq+ vWFqNrR+++k
  Aradu.DX46F 40 REKKKRLTSSQIESLERSFQEEIKLDSDRKIKLSRELGLQPRQIAVWFQNRRTRWK 95
                 567888*************************************************9 PP

2HD-ZIP_I/II112.62.5e-3641133193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekk+rl++ q+++LE+sF+ee kL+++rK +l+reLglqprq+avWFqnrR R+k+kqlE+ y aLk+++d++++e+++L++ev  L+++l+e
  Aradu.DX46F  41 EKKKRLTSSQIESLERSFQEEIKLDSDRKIKLSRELGLQPRQIAVWFQNRRTRWKAKQLEHLYFALKHEFDHISNEKHKLQEEVMMLKASLRE 133
                  69**************************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.76E-192799IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-193097IPR009057Homeodomain-like
PROSITE profilePS5007117.5243797IPR001356Homeobox domain
SMARTSM003895.3E-1739101IPR001356Homeobox domain
CDDcd000864.83E-154098No hitNo description
PfamPF000462.5E-164095IPR001356Homeobox domain
PRINTSPR000318.3E-56877IPR000047Helix-turn-helix motif
PROSITE patternPS0002707295IPR017970Homeobox, conserved site
PRINTSPR000318.3E-57793IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010434Biological Processbract formation
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MTILITLLSG SGSEVKQAAL VETPQESLHA MAEVKYAGHR EKKKRLTSSQ IESLERSFQE  60
EIKLDSDRKI KLSRELGLQP RQIAVWFQNR RTRWKAKQLE HLYFALKHEF DHISNEKHKL  120
QEEVMMLKAS LREQAFRAHV SGVYTEMSGA ETGLNQAEHE LRMEAQFYGN GAYMCAFHRY  180
EIKGG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18997RRTRWKAKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00486DAPTransfer from AT5G03790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016206531.11e-90PREDICTED: homeobox-leucine zipper protein ATHB-22-like
SwissprotQ9LZR05e-45ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLA0A0S3RYX61e-58A0A0S3RYX6_PHAAN; Uncharacterized protein
TrEMBLA0A0B2QAV41e-58A0A0B2QAV4_GLYSO; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLK7KFW71e-58K7KFW7_SOYBN; Uncharacterized protein
STRINGGLYMA03G34710.24e-58(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33943466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.13e-46homeobox 51